The short version of Nuclear receptor fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2026-03-02 and is reviewed periodically as new material appears.
Regulatory treatment of cardarine differs by context and jurisdiction. In competitive sport, the World Anti-Doping Agency lists PPARδ agonists, including GW501516, as prohibited at all times. Outside sport, it lacks approval as a prescription medicine in major drug markets, and products sold for human consumption may be treated as unapproved drugs. Some countries also restrict importation or sale through general consumer protection and medicines laws. These classifications affect availability, testing, and legal risk without establishing therapeutic value.
Because cardarine is not an approved medicine, no pharmacopeial monograph defines its identity, purity, or storage requirements. Laboratories typically rely on in-house methods and reference standards when testing materials labeled as GW501516. Certificates of analysis may report purity and identity for a specific batch, but their scope varies and they do not guarantee safety or legal status. Independent verification can include high-performance liquid chromatography, mass spectrometry, nuclear magnetic resonance, and elemental analysis. The distinction between research chemical labeling and human use is significant because quality standards and oversight differ.
Cardarine is a common name for GW501516, a synthetic compound studied for its effects on lipid and glucose metabolism. It functions as an agonist at peroxisome proliferator-activated receptor delta, or PPARδ, a nuclear receptor that influences gene expression. The molecule is not a steroid, nor is it a selective androgen receptor modulator. It is also known in research and sports literature as GW-501516 and endurobol. Early laboratory work examined its metabolic activity in cell cultures and animal models.
Activation of PPARδ changes transcription of genes involved in fatty acid transport, mitochondrial function, and skeletal muscle fuel preference. In rodent studies, pharmacological PPARδ activation was associated with increased endurance and altered body composition. These findings generated interest in performance enhancement, but species differences and study designs limit direct extrapolation to humans. Small human trials were conducted in the 2000s and later discontinued. The extent to which cardarine produces similar metabolic or performance effects in people remains an open question.
| Property | Value | Notes |
|---|---|---|
| WADA classification | S4 Hormone and Metabolic Modulators | Prohibited at all times in sport. |
| Drug approval status | Not approved in major jurisdictions | No accepted therapeutic indication. |
| Common detection method | LC-MS/MS | Detects parent compound and metabolites. |
| Typical test matrix | Urine or blood | Urine is common in anti-doping testing. |
| Product labeling | Research chemical or supplement | Often not independently verified. |
Regulatory treatment varies, but cardarine is not approved as a medicine. Sports authorities list GW501516 as a prohibited substance, and it is banned at all times under the World Anti-Doping Agency code. Many countries restrict sales for human consumption, while online vendors market it as a research chemical. Such products may lack purity data, and their actual contents can differ from the label. Purchasing or possessing cardarine may carry legal consequences depending on jurisdiction. The compound is not a dietary supplement ingredient in regulated markets.
Clinical development stopped after rodent studies showed tumors at multiple sites. Whether those findings predict human cancer risk remains an open question, but they led sponsors to discontinue programs. Human safety data are limited to small, short-term studies that were not designed to assess cancer risk. Reported effects in those studies included changes in blood lipids, but the evidence is insufficient for medical use. Long-term consequences of nonmedical use are not well characterized. Questions about dose, duration, and individual susceptibility remain unresolved.
Cardarine is a common name for GW501516, an investigational compound developed in the 1990s for metabolic conditions. It acts as an agonist at peroxisome proliferator-activated receptor delta, a nuclear receptor involved in lipid and energy metabolism. The compound is frequently mislabeled as a selective androgen receptor modulator, or SARM, but its molecular target is different. GW501516 reached early clinical testing before development was discontinued. It has no approved therapeutic use in any country. The name cardarine is not a formal international nonproprietary name.
GW501516 acts as an agonist at the peroxisome proliferator-activated receptor delta, a nuclear receptor that regulates gene expression. Activation shifts transcription toward genes involved in fatty acid uptake, oxidation, and energy expenditure. The compound does not bind the androgen receptor and therefore differs from anabolic steroids and SARMs. In rodent models, this metabolic shift has been linked to increased running endurance and reduced fat accumulation. The exact downstream pathways in humans remain incompletely characterized.
Early clinical research explored GW501516 for lipid disorders, obesity, and diabetes. Some short-term human studies reported changes in HDL cholesterol, LDL cholesterol, and triglycerides. The development program was discontinued after rodent studies showed dose-dependent tumor formation in multiple tissues, including liver, bladder, stomach, and skin. These findings raised concerns about long-term cancer risk in humans. Because human exposure data are limited, the clinical significance of the rodent tumors remains uncertain.
Literature on cardarine often separates receptor pharmacology from toxicology. Mechanistic papers describe PPARδ activation and gene expression changes, while safety assessments focus on carcinogenicity and species differences. Questions remain about whether rodent tumors arise through PPARδ-dependent or off-target mechanisms. Another open area is how human metabolism and exposure compare with those in animal studies. Analytical methods such as liquid chromatography–mass spectrometry are used to confirm identity in biological and product samples.
Stability of GW501516 depends on form, temperature, light exposure, and moisture. Solid reference material is typically stored frozen or refrigerated in a desiccator and protected from light. Solutions in organic solvents such as dimethyl sulfoxide are often kept frozen in aliquots to reduce freeze-thaw cycling. Aqueous solubility is low, so aqueous stock solutions can be difficult to prepare without cosolvents. Degradation may appear as changes in chromatographic purity or mass spectral signal. Stability studies are needed to establish shelf life for any specific preparation.
Quality assessment for cardarine samples usually combines identity, purity, and impurity testing. Nuclear magnetic resonance spectroscopy and mass spectrometry can confirm molecular structure, while high-performance liquid chromatography estimates purity. Certificates of analysis from testing laboratories may list these results, but they do not establish safety or legality. In the absence of approved manufacturing, products sold online may contain the wrong compound, variable amounts, or unlisted contaminants. Independent verification is therefore central to analytical work and to interpreting any reported biological activity.
Laboratory detection of GW501516 commonly uses liquid chromatography coupled with tandem mass spectrometry. The method can identify the parent compound or its metabolites in urine and blood after sample cleanup. Protein precipitation, solid-phase extraction, or enzymatic hydrolysis may precede analysis, depending on the matrix. Reference standards are required for accurate quantification and confirmation. Because the compound is not approved, testing often occurs in anti-doping, forensic, or research settings rather than routine clinical care. Results are reported with limits of detection and quantification.
=== Cyanotoxins === In recent years, there has been an increase of cyanobacterial blooms due to the eutrophication (or increase in nutrient levels) of surface waters around the world. Increases in certain nutrients, such as nitrogen and phosphorus, are linked to fertilizer runoff from agricultural fields, and are also found in certain products, such as detergents, in urban spaces. These blooms can release toxins that can decrease water quality and are a risk to human and wildlife health. Additionally, there are a lack of regulations regarding the maximum contaminant levels (MCL) allowed in drinking water sources. Cyanotoxins can have both acute and chronic toxic effects, and there are often many consequences for the health of the environment where these blooms occur.
== History == In 1959, physicist Richard Feynman gave a talk titled "There's Plenty of Room at the Bottom" to the American Physical Society. He imagined a world in which "we could arrange atoms one by one, just as we want them." This idea set the stage for the bottom-up synthesis approach in which constituent components interact to form higher-ordered structures in a controllable manner. The study of self-assembly of nanoparticles began with recognition that some properties of atoms and molecules enable them to arrange themselves into patterns. A variety of applications where the self-assembly of nanoparticles might be useful. For example, building sensors or computer chips. Definition Self-assembly is defined as a process in which individual units of material associate with themselves spontaneously into a defined and organized structure or larger units with minimal external direction. Self-assembly is recognized as a highly useful technique to achieve outstanding qualities in both organic and inorganic nanostructures. According to George M.
Cathelicidin antimicrobial peptide (CAMP) is an antimicrobial peptide encoded in the human by the CAMP gene. The active form is LL-37, a 37 amino acid peptide having sequence [LL-37, 37 aa] In humans, CAMP encodes the peptide precursor CAP-18 (18 kDa), which is processed by proteinase 3-mediated extracellular cleavage into the active form LL-37. The cathelicidin family includes 30 types of which LL-37 is the only cathelicidin in the human. Cathelicidins are stored in the secretory granules of neutrophils and macrophages and can be released following activation by leukocytes. Cathelicidin peptides are dual-natured molecules called amphiphiles: one end of the molecule is attracted to water and repelled by fats and proteins, and the other end is attracted to fat and proteins and repelled by water. Members of this family react to pathogens by disintegrating, damaging, or puncturing cell membranes. Cathelicidins thus serve a critical role in mammalian innate immune defense against invasive bacterial infection. The cathelicidin family of peptides are classified as antimicrobial peptides (AMPs). The AMP family also includes the defensins. Whilst the defensins share common structural features, cathelicidin-related peptides are highly heterogeneous. Members of the cathelicidin family of antimicrobial polypeptides are characterized by a highly conserved region (cathelin domain) and a highly variable cathelicidin peptide domain. Cathelicidin peptides have been isolated from many different species of mammals, including marsupials.
Sources: en.wikipedia.org
=== Industrial === Industrial biotechnology (known mainly in Europe as white biotechnology) is the application of biotechnology for industrial purposes, including industrial fermentation. It includes the practice of using cells such as microorganisms, or components of cells like enzymes, to generate industrially useful products in sectors such as chemicals, food and feed, detergents, paper and pulp, textiles and biofuels. In the current decades, significant progress has been done in creating genetically modified organisms (GMOs) that enhance the diversity of applications and economical viability of industrial biotechnology. By using renewable raw materials to produce a variety of chemicals and fuels, industrial biotechnology is actively advancing towards lowering greenhouse gas emissions and moving away from a petrochemical-based economy. Synthetic biology is considered one of the essential cornerstones in industrial biotechnology due to its financial and sustainable contribution to the manufacturing sector. Jointly biotechnology and synthetic biology play a crucial role in generating cost-effective products with nature-friendly features by using bio-based production instead of fossil-based. Synthetic biology can be used to engineer model microorganisms, such as Escherichia coli, by genome editing tools to enhance their ability to produce bio-based products, such as bioproduction of medicines and biofuels. For instance, E.
==== Indoor air ==== Humans spend more and more time in a confined atmosphere (around 80-90% of the time in a building or vehicle). According to the French Agency for Food, Environmental and Occupational Health & Safety (ANSES) and various actors in France, the CO2 rate in the indoor air of buildings (linked to human or animal occupancy and the presence of combustion installations), weighted by air renewal, is "usually between about 350 and 2,500 ppm". In homes, schools, nurseries and offices, there are no systematic relationships between the levels of CO2 and other pollutants, and indoor CO2 is statistically not a good predictor of pollutants linked to outdoor road (or air, etc.) traffic. CO2 is the parameter that changes the fastest (with hygrometry and oxygen levels when humans or animals are gathered in a closed or poorly ventilated room). In poor countries, many open hearths are sources of CO2 and CO emitted directly into the living environment.
=== Laboratory synthesis === Formaldehyde was discovered in 1859 by the Russian chemist Aleksandr Butlerov (1828–1886) when he tried to synthesize methanediol ("methylene glycol") from iodomethane and silver oxalate. In his paper, Butlerov called formaldehyde "dioxymethylen" (methylene dioxide) because his empirical formula for it was incorrect, as atomic weights were not precisely determined until the Karlsruhe Congress. August Wilhelm von Hofmann first identified the compound as an aldehyde. He announced its production by passing methanol vapor in air over hot platinum wire. With modifications, Hofmann's method remains the basis of the modern industrial route. Solution routes to formaldehyde also entail oxidation of methanol or iodomethane.
== Clinical significance == Truncation mutations in MYBPC3 stand as the primary cause of hypertrophic cardiomyopathy (HCM). To date, roughly 350 mutations in MYBPC3 have been identified, and in large part, the mutations result in protein truncation, shifts in reading frames, and premature termination codons. Genetic studies have revealed significant overlap between genotypes and phenotypes as MYBPC3 mutations can lead to various forms of cardiomyopathies, such as dilated cardiomyopathy and left ventricular noncompaction cardiomyopathy. In patients with isolated or familial cases of dilated cardiomyopathy, MYBPC3 mutations represented the second highest number of known mutations. Furthermore, a 25-bp intronic MYBPC3 deletion leading to protein truncation is present in 4% of the population in South India and is associated with a higher risk to develop heart failure. Founder MYBPC3 mutations have been reported in Iceland, Italy, The Netherlands, Japan, France and Finland, where they represent a large percentage of cases with hypertrophic cardiomyopathy. All of them are truncating mutations, resulting in a shorter protein, lacking the regulatory phosphorylatable M motif and/or major binding domains to other sarcomeric proteins. A body of evidence indicates that patients with more than one mutation often develop a more severe phenotype, and a significant fraction of childhood-onset hypertrophic cardiomyopathy (14%) is caused by compound genetic variants. This suggests that a gene-dosage effect might be responsible for manifestations at a younger age.
Sources: en.wikipedia.org
Navy Warrant Officer Class 1 D Lennon Chief Petty Officer M Rodway Army Warrant Officer Class 1 Matthew James Anderson, Royal Corps of Signals Warrant Officer Class 1 Rupert St John Hardington Banfield, , Army Air Corps Warrant Officer Class 1 Peter Bernthal, Corps of Royal Electrical and Mechanical Engineers Staff Sergeant Troy David Binding Corps of Royal Electrical and Mechanical Engineers Warrant Officer Class 2 Aarron David Butterworth, Corps of Royal Engineers Warrant Officer Class 1 (now Captain) Adam Daniel Cooksey, Royal Regiment of Artillery Warrant Officer Class 1 (now Captain) Leslie Trevor Dinsmore, Corps of Royal Electrical and Mechanical Engineers Warrant Officer Class 2 Darren Lee Duckitt, The Royal Yorkshire Regiment Warrant Officer Class 2 Kulbahadur Ghale, The Royal Gurkha Rifles Warrant Officer Class 1 (now Captain) Marc Kevin Giles, , The Mercian Regiment Warrant Officer Class 1 Philip John Greenway, Royal Regiment of Artillery Warrant Officer Class 1 Adam Charles Ireland, The Parachute Regiment Warrant Officer Class 1 Manojkumar Jugjali, The Royal Gurkha Rifles Warrant Officer Class 1 Carley Lorraine Lambert, Royal Regiment of Artillery Warrant Officer Class 1 James Lee Lightfoot, Royal Regiment of Artillery Warrant Officer Class 1 (now Captain) Daniel Andrew Long, The Rifles Warrant Officer Class 1 James Derek Mayoh, Royal Regiment of Artillery Warrant Officer Class 1 (now Captain) Stuart Russell McCreadie, Royal Corps of Signals Warrant Officer Class 1 Peter Steven Meager, Corps of Royal Electrical and Mechanical Engineers Warrant Officer Class 1 (now Captain) Ryan Daniel O'Neill, The Royal Regiment of Scotland Warrant Officer Class 1 James Edward Phillips, Corps of Royal Electrical and Mechanical Engineers Warrant Officer Class 2 Michael John Potts, Royal Army Medical Corps Warrant Officer Class 2 Prakash Rai, Royal Army Medical Corps Warrant Officer Class 2 Kyle Reains, Irish Guards Warrant Officer Class 1 James Wright Reid, Corps of Royal Electrical and Mechanical Engineers Warrant Officer Class 1 James Oliver Richardson, Royal Regiment of Artillery Warrant Officer Class 1 Aran Christopher Rushe, Royal Army Medical Corps Warrant Officer Class 1 Grant Spencer Sewell-Jones, Royal Corps of Army Music Warrant Officer Class 1 Paul Sheenan, Corps of Royal Electrical and Mechanical Engineers Warrant Officer Class 1 Melanie Louise Silvester, Adjutant General's Corps (Staff and Personnel Support Branch) Warrant Officer Class 1 (now Captain) Garry Andrew Smurthwaite, The Parachute Regiment Warrant Officer Class 2 David Robert John Steel, The Royal Scots Dragoon Guards Warrant Officer Class 1 John Ian Sweeney, Army Air Corps Warrant Officer Class 2 (now Captain) Trevor Albert Tuhey, Royal Army Physical Training Corps Warrant Officer Class 1 Russell James Underwood, Corps of Royal Electrical and Mechanical Engineers Warrant Officer Class 2 George Ferguson Francis Wong Vesi, Adjutant General's Corps (Staff and Personnel Support Branch) Warrant Officer Class 1 (now Captain) Jonathan George Werrett, The Mercian Regiment Warrant Officer Class 1 Joseph Thomas Williams, Corps of Royal Electrical and Mechanical Engineers Warrant Officer Class 1 Michael James Williams, Royal Corps of Signals Warrant Officer Class 1 David Wood, Corps of Royal Electrical and Mechanical Engineers Warrant Officer Class 1 Craig Michael Woodall, Royal Army Veterinary Corps Warrant Officer Class 2 Robert Steven Young, Welsh Guards Air Force Warrant Officer (now Flight Lieutenant) J. Blinkhorn Warrant Officer (now Flight Lieutenant) H. Dimeck Warrant Officer (now Flight Lieutenant) F.E. Hunt Warrant Officer D.P. Burke Warrant Officer W.O.R Clements Warrant Officer N.W. Cook Master Aircrew A.R. Davey, Warrant Officer J.C. Foxall Warrant Officer D.G. Jackson Warrant Officer K.E. Jones Warrant Officer E.L. Kerslake Warrant Officer M.E. Larkin Warrant Officer D.A. Lawrence Warrant Officer R. Laycock Warrant Officer B. Moore Warrant Officer C.L.S Old Master Aircrew S.R. Parsons Warrant Officer K.N. Phillips Warrant Officer S.G. Rowbotham Warrant Officer A. Wilson Warrant Officer P.B. Wilson, Warrant Officer S.M. Wooles Acting Warrant Officer K.S. Edwards Acting Warrant Officer A.S. MacDonald Flight Sergeant M.J. Moore Flight Sergeant J.C. O'Grady Flight Sergeant J.A. Simpkins Flight Sergeant C.A. Smith Flight Sergeant P.S. Ware Flight Sergeant L.A. Williams Chief Technician D.G. Bristow Sergeant E.P. Jones
This method allows identification of poisons at a few parts per billion, but that may be insufficient for reliable detection of the isotopic signature of the adducts, and therefore an unambiguous identification of the geographic origin of the poison.
== History == Roadie was founded by Marc Gorlin, a co-founder of Kabbage and founder of VerticalOne and Pretty Good Privacy, as a same-day and urgent delivery company in 2014. In January 2015, Roadie launched the first consumer to consumer (C2C) version of its app with a Series A funding round of $10 million. In February, Roadie announced a partnership with Waffle House to designate its restaurants "Roadie Roadhouses", offering a neutral meeting place for drivers and senders. Drivers receive free food and drink through the partnership. In May, late-night host Jimmy Kimmel discussed the Roadie-Waffle House relationship in an opening monologue on Jimmy Kimmel Live!. Roadie's driver network expanded significantly as a result. Roadie closed a Series B round of funding in June, raising $15 million, and its first business to business (B2B) app version launched that November. In 2015, Delta Air Lines signed an agreement with Roadie to deliver mishandled luggage, becoming Roadie’s first enterprise customer. Roadie launched a pilot program with Delta at Daytona Beach International Airport. Since then, the relationship has expanded to include over 70 airports around the United States and a first mile/last mile line haul relationship with Delta Cargo. In 2017, the company signed a deal with The Home Depot, also based in Atlanta, and in February 2019, closed a Series C round of funding. In October 2019, Roadie and Delta Cargo announced a partnership to create a same-day cross-country delivery offering, DASH Door-to-Door, the first of its kind from a U.S. passenger airline.
Sources: en.wikipedia.org
Anti-doping laboratories typically use LC-MS/MS to detect GW501516 and its metabolites in urine. The method is sensitive and can identify the compound at low concentrations. Detection depends on sample timing, metabolism, and the specific assay.
Legality varies by country and context. It lacks marketing approval as a medicine in major countries. Sports organizations prohibit its use at all times.
A certificate of analysis may report identity, purity, and testing methods for a specific batch. It does not guarantee safety or legal status. Independent verification can confirm whether the material matches the label.
Cardarine is a common name for GW501516, a synthetic PPARδ agonist. It is not a steroid or a selective androgen receptor modulator. It was developed and studied as a research compound for metabolic pathways.